PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0381s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 353aa    MW: 39189.7 Da    PI: 7.6802
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0381s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.9e-32202256155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k r+rWt++LH++Fve+v++LGGs+kAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Kalax.0381s0030.1.p 202 KMRIRWTQDLHDKFVECVNRLGGSDKATPKAILKLMDSDGLTIFHVKSHLQKYRT 256
                          67****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.041199259IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-28200257IPR009057Homeodomain-like
SuperFamilySSF466891.59E-16200256IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23202257IPR006447Myb domain, plants
PfamPF002491.6E-8206255IPR001005SANT/Myb domain
PfamPF143798.6E-21283329IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MNSHDNNNGL ERIRLNHGLM SSGCSYDFVN SSYSSSVSQP DPRWHSMGGG GGGSEIMHSQ  60
TLITPTKLPS TILSRLGSPA SAFYATERCM AGFPQSRLDQ TPSFPLDSQF MNTLQSVVQP  120
HLLTANQYKS VFRNPAISGN STLAPTVSIP FRGIPDDKFC SSSSANTGLF SWSQTDGRNQ  180
YVETCSSHTT NRFSPGSTLS SKMRIRWTQD LHDKFVECVN RLGGSDKATP KAILKLMDSD  240
GLTIFHVKSH LQKYRTAKYL PESTEGKDTR SESVHLDMKT GLQIKEALQM QLDVQKTLHE  300
QLEIQRNLQL RIEEQGKQLR MMFDQHHKTN TSSSGHDPTE DNHPCEDTSV QS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006587215.12e-86PREDICTED: protein PHR1-LIKE 1-like isoform X1
TrEMBLA0A0B2PVD62e-86A0A0B2PVD6_GLYSO; Myb family transcription factor APL
TrEMBLK7LD832e-86K7LD83_SOYBN; Uncharacterized protein
STRINGGLYMA09G17404.17e-86(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.15e-67G2-like family protein